PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009149863.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 346aa    MW: 39375 Da    PI: 4.9751
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009149863.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601223.2e-38381381101
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     aCaaCk++rr+Ca+dC+lapyfpaeqpk f+nvh+lFG++ ++k+l++l+e +r++am+s+++++ +r r+Pv+G++g+ ++lq  +  +++el+
  XP_009149863.1  38 ACAACKYQRRRCAADCPLAPYFPAEQPKLFQNVHRLFGVRSIVKILENLDELQRPEAMKSIIFQSYVRDRNPVHGCLGITQQLQYMIWVAEEELK 132
                     7********************************************************************************************** PP

          DUF260  96 llkeel 101
                     +++++l
  XP_009149863.1 133 AVNSQL 138
                     999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.29437138IPR004883Lateral organ boundaries, LOB
PfamPF031957.4E-3538135IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009556Biological Processmicrosporogenesis
GO:0009786Biological Processregulation of asymmetric cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MSQIKTIHNP IGSLERFLDL LLISLIVYMT LKGGTSGACA ACKYQRRRCA ADCPLAPYFP  60
AEQPKLFQNV HRLFGVRSIV KILENLDELQ RPEAMKSIIF QSYVRDRNPV HGCLGITQQL  120
QYMIWVAEEE LKAVNSQLQL YRNGQNHPNP HNMMIHELGE KQDLTSQLDL GMGLPVNDNN  180
QGNNTIPFFS PVSETQQQPP HMSYCSDQVN NHDYNPTPDS CKEVVNNHNT SLAWGQNQFP  240
YNHHNYGFIN QNEHCSEPKN NNSVMAIQSQ LVNLQMASNQ QEEEVDDQNY DEIHQFLEII  300
DESQSFTETK EVYASSSGES LKEPIDEVGE KELRRAATCF SLTSVN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009149863.10.0PREDICTED: LOB domain-containing protein 27
RefseqXP_013706013.10.0PREDICTED: LOB domain-containing protein 27-like
SwissprotQ9STS61e-120LBD27_ARATH; LOB domain-containing protein 27
TrEMBLA0A078HJA30.0A0A078HJA3_BRANA; BnaA06g17030D protein
STRINGBra018102.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63032746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.11e-122LOB domain-containing protein 27